SCOP 1.73: Domain d2etnc2: 2etn C:78-156

Lineage for d2etnc2 (2etn C:78-156)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)

6. Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
   N-terminal domain is a long alpha-hairpin

7. Species Thermus aquaticus [TaxId:271] [143117] (1 PDB entry)

8. Domain d2etnc2: 2etn C:78-156 [132370]
   Other proteins in same PDB: d2etna1, d2etnb1, d2etnc1
   automatically matched to 2ETN A:78-156

Details for d2etnc2

PDB Entry: 2etn, 3.3 Å

PDB Description: Crystal structure of Thermus aquaticus Gfh1

PDB Compounds: (C:) anti-cleavage anti-GreA transcription factor Gfh1

SCOP Domain Sequences for d2etnc2:

Sequence; same for both SEQRES and ATOM records:

>d2etnc2 d.26.1.2 (C:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus aquaticus [TaxId: 271]}
gtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisdaspmgkallghrvgdv
lsldtpkgkkefrvvaihg

Timeline for d2etnc2:

• d2etnc2 is new in SCOP 1.73
  
• d2etnc2 appears in SCOP 1.75
  
• d2etnc2 appears in the current release, SCOPe 2.08