![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein) automatically mapped to Pfam PF01272 |
![]() | Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species) N-terminal domain is a long alpha-hairpin |
![]() | Species Thermus aquaticus [TaxId:271] [143117] (1 PDB entry) Uniprot Q8VQD7 78-156 |
![]() | Domain d2etnc2: 2etn C:78-156 [132370] Other proteins in same PDB: d2etna1, d2etnb1, d2etnc1 automatically matched to 2ETN A:78-156 |
PDB Entry: 2etn (more details), 3.3 Å
SCOPe Domain Sequences for d2etnc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2etnc2 d.26.1.2 (C:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus aquaticus [TaxId: 271]} gtgeviglgsvveledpatgerlsvqvvspaeasvlenpmkisdaspmgkallghrvgdv lsldtpkgkkefrvvaihg
Timeline for d2etnc2:
![]() Domains from other chains: (mouse over for more information) d2etna1, d2etna2, d2etnb1, d2etnb2 |