Lineage for d2es3a_ (2es3 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1780927Family b.29.1.4: Laminin G-like module [49944] (7 proteins)
  6. 1780999Protein Thrombospondin 1 N-terminal domain [141150] (1 species)
  7. 1781000Species Human (Homo sapiens) [TaxId:9606] [141151] (6 PDB entries)
    Uniprot P07996 28-233! Uniprot P07996 29-233
  8. 1781002Domain d2es3a_: 2es3 A: [132310]
    automated match to d1z78a1

Details for d2es3a_

PDB Entry: 2es3 (more details), 1.85 Å

PDB Description: Crystal Structure of Thrombospondin-1 N-terminal Domain in P1 Form at 1.85A Resolution
PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d2es3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2es3a_ b.29.1.4 (A:) Thrombospondin 1 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
ggdnsvfdifeltgaarkgsgrrlvkgpdpsspafriedanlippvpddkfqdlvdavrt
ekgflllaslrqmkktrgtllalerkdhsgqvfsvvsngkagtldlsltvqgkqhvvsve
eallatgqwksitlfvqedraqlyidcekmenaeldvpiqsvftrdlasiarlriakggv
ndnfqgvlqnvrfvfgttpedilrnkgcs

SCOPe Domain Coordinates for d2es3a_:

Click to download the PDB-style file with coordinates for d2es3a_.
(The format of our PDB-style files is described here.)

Timeline for d2es3a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2es3b_