SCOPe 2.01: Domain d2eilg_: 2eil G:

Lineage for d2eilg_ (2eil G:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (22 PDB entries)

8. Domain d2eilg_: 2eil G: [132202]
   Other proteins in same PDB: d2eila_, d2eilb1, d2eilb2, d2eilc_, d2eild_, d2eile_, d2eilf_, d2eilh_, d2eili_, d2eilj_, d2eilk_, d2eill_, d2eilm_, d2eiln_, d2eilo1, d2eilo2, d2eilp_, d2eilq_, d2eilr_, d2eils_, d2eilu_, d2eilv_, d2eilw_, d2eilx_, d2eily_, d2eilz_
   automated match to d1occg_
   complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eilg_

PDB Entry: 2eil, 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully oxidized state

PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOPe Domain Sequences for d2eilg_:

Sequence; same for both SEQRES and ATOM records:

>d2eilg_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d2eilg_:

• d2eilg_ first appeared in SCOP 1.73, called d2eilg1
  
• d2eilg_ was called d2eilg1 in SCOP 1.75
  
• d2eilg_ appears in SCOPe 2.02
  
• d2eilg_ appears in the current release, SCOPe 2.08