Lineage for d2eiko2 (2eik O:1-90)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237582Fold f.17: Transmembrane helix hairpin [81334] (5 superfamilies)
    two antiparallel transmembrane helices
  4. 1237604Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (1 family) (S)
  5. 1237605Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (4 proteins)
  6. 1237631Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 1237632Species Cow (Bos taurus) [TaxId:9913] [81454] (14 PDB entries)
  8. 1237644Domain d2eiko2: 2eik O:1-90 [132183]
    Other proteins in same PDB: d2eika_, d2eikb1, d2eikc_, d2eikd_, d2eike_, d2eikf_, d2eikg_, d2eikh_, d2eiki_, d2eikj_, d2eikk_, d2eikl_, d2eikm_, d2eikn_, d2eiko1, d2eikp_, d2eikq_, d2eikr_, d2eiks_, d2eikt_, d2eiku_, d2eikv_, d2eikw_, d2eikx_, d2eiky_, d2eikz_
    automatically matched to d1occb2
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eiko2

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2eiko2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eiko2 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d2eiko2:

Click to download the PDB-style file with coordinates for d2eiko2.
(The format of our PDB-style files is described here.)

Timeline for d2eiko2: