Lineage for d2eikg1 (2eik G:1-84)

  1. Root: SCOP 1.75
  2. 886031Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)
  3. 887128Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 887161Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
  5. 887162Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (1 protein)
  6. 887163Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 887164Species Cow (Bos taurus) [TaxId:9913] [81408] (14 PDB entries)
  8. 887175Domain d2eikg1: 2eik G:1-84 [132174]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eike1, d2eikf1, d2eikh1, d2eiki1, d2eikj1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eikr1, d2eiks1, d2eiku1, d2eikv1, d2eikw1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1occg_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eikg1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (G:) Cytochrome c oxidase polypeptide VIa-heart

SCOP Domain Sequences for d2eikg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eikg1 f.23.2.1 (G:1-84) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOP Domain Coordinates for d2eikg1:

Click to download the PDB-style file with coordinates for d2eikg1.
(The format of our PDB-style files is described here.)

Timeline for d2eikg1: