Lineage for d2eike1 (2eik E:5-109)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776040Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (1 family) (S)
  5. 776041Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (1 protein)
  6. 776042Protein Cytochrome c oxidase subunit E [48481] (1 species)
  7. 776043Species Cow (Bos taurus) [TaxId:9913] [48482] (14 PDB entries)
  8. 776054Domain d2eike1: 2eik E:5-109 [132172]
    Other proteins in same PDB: d2eika1, d2eikb1, d2eikb2, d2eikc1, d2eikd1, d2eikf1, d2eikg1, d2eikh1, d2eiki1, d2eikj1, d2eikk1, d2eikl1, d2eikm1, d2eikn1, d2eiko1, d2eiko2, d2eikp1, d2eikq1, d2eiks1, d2eikt1, d2eiku1, d2eikv1, d2eikw1, d2eikx1, d2eiky1, d2eikz1
    automatically matched to d1occe_
    complexed with cd, cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eike1

PDB Entry: 2eik (more details), 2.1 Å

PDB Description: Cadmium ion binding structure of bovine heart cytochrome C oxidase in the fully reduced state
PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOP Domain Sequences for d2eike1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eike1 a.118.11.1 (E:5-109) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

SCOP Domain Coordinates for d2eike1:

Click to download the PDB-style file with coordinates for d2eike1.
(The format of our PDB-style files is described here.)

Timeline for d2eike1: