SCOP 1.75: Domain d2eijk1: 2eij K:6-54

Lineage for d2eijk1 (2eij K:6-54)

1. Root: SCOP 1.75

2. Class f: Membrane and cell surface proteins and peptides [56835] (58 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.5: Mitochondrial cytochrome c oxidase subunit VIIb [81423] (1 family)

5. Family f.23.5.1: Mitochondrial cytochrome c oxidase subunit VIIb [81422] (1 protein)

6. Protein Mitochondrial cytochrome c oxidase subunit VIIb [81421] (1 species)
   function unknown, probably acts as a regulator or is required for the assembly

7. Species Cow (Bos taurus) [TaxId:9913] [81420] (14 PDB entries)

8. Domain d2eijk1: 2eij K:6-54 [132150]
   Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijf1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijs1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijy1, d2eijz1
   automatically matched to d1occk_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijk1

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (K:) Cytochrome c oxidase polypeptide VIIb

SCOP Domain Sequences for d2eijk1:

Sequence; same for both SEQRES and ATOM records:

>d2eijk1 f.23.5.1 (K:6-54) Mitochondrial cytochrome c oxidase subunit VIIb {Cow (Bos taurus) [TaxId: 9913]}
apdfhdkygnavlasgatfcvavwvymatqigiewnpspvgrvtpkewr

Timeline for d2eijk1:

• d2eijk1 first appeared in SCOP 1.73
  
• d2eijk1 is called d2eijk_ in SCOPe 2.01
  
• d2eijk1 appears in the current release, SCOPe 2.08, called d2eijk_