SCOP 1.75: Domain d2eijf1: 2eij F:1-98

Lineage for d2eijf1 (2eij F:1-98)

1. Root: SCOP 1.75

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
   metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2

4. Superfamily g.41.5: Rubredoxin-like [57802] (3 families)

5. Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (1 protein)
   membrane-anchored rubredoxin-like domain

6. Protein Cytochrome c oxidase Subunit F [57819] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57820] (14 PDB entries)

8. Domain d2eijf1: 2eij F:1-98 [132145]
   Other proteins in same PDB: d2eija1, d2eijb1, d2eijb2, d2eijc1, d2eijd1, d2eije1, d2eijg1, d2eijh1, d2eiji1, d2eijj1, d2eijk1, d2eijl1, d2eijm1, d2eijn1, d2eijo1, d2eijo2, d2eijp1, d2eijq1, d2eijr1, d2eijt1, d2eiju1, d2eijv1, d2eijw1, d2eijx1, d2eijy1, d2eijz1
   automatically matched to d1occf_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eijf1

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (F:) Cytochrome c oxidase polypeptide Vb

SCOP Domain Sequences for d2eijf1:

Sequence; same for both SEQRES and ATOM records:

>d2eijf1 g.41.5.3 (F:1-98) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

Timeline for d2eijf1:

• d2eijf1 first appeared in SCOP 1.73
  
• d2eijf1 is called d2eijf_ in SCOPe 2.01
  
• d2eijf1 appears in the current release, SCOPe 2.08, called d2eijf_