SCOPe 2.07: Domain d2eije_: 2eij E:

Lineage for d2eije_ (2eij E:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.11: Cytochrome c oxidase subunit E [48479] (2 families)
   automatically mapped to Pfam PF02284

5. Family a.118.11.1: Cytochrome c oxidase subunit E [48480] (2 proteins)

6. Protein Cytochrome c oxidase subunit E [48481] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48482] (49 PDB entries)

8. Domain d2eije_: 2eij E: [132144]
   Other proteins in same PDB: d2eija_, d2eijb1, d2eijb2, d2eijc_, d2eijd_, d2eijf_, d2eijg_, d2eijh_, d2eiji_, d2eijj_, d2eijk_, d2eijl_, d2eijm_, d2eijn_, d2eijo1, d2eijo2, d2eijp_, d2eijq_, d2eijs_, d2eijt_, d2eiju_, d2eijv_, d2eijw_, d2eijx_, d2eijy_, d2eijz_
   automated match to d1occe_
   complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, pgv, psc, tgl, zn

Details for d2eije_

PDB Entry: 2eij, 1.9 Å

PDB Description: Bovine heart cytochrome C oxidase in the fully reduced state

PDB Compounds: (E:) Cytochrome c oxidase polypeptide Va

SCOPe Domain Sequences for d2eije_:

Sequence; same for both SEQRES and ATOM records:

>d2eije_ a.118.11.1 (E:) Cytochrome c oxidase subunit E {Cow (Bos taurus) [TaxId: 9913]}
hetdeefdarwvtyfnkpdidawelrkgmntlvgydlvpepkiidaalracrrlndfasa
vrilevvkdkagphkeiypyviqelrptlnelgistpeelgldkv

Timeline for d2eije_:

• d2eije_ first appeared in SCOP 1.73, called d2eije1
  
• d2eije_ appears in SCOPe 2.06
  
• d2eije_ appears in the current release, SCOPe 2.08