Lineage for d2eida2 (2eid A:1-150)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775232Species Fusarium graminearum (Gibberella zeae) [TaxId:5518] [255145] (5 PDB entries)
  8. 2775236Domain d2eida2: 2eid A:1-150 [132134]
    Other proteins in same PDB: d2eida1, d2eida3
    automated match to d1gofa2
    complexed with cu, na; mutant

Details for d2eida2

PDB Entry: 2eid (more details), 2.2 Å

PDB Description: galactose oxidase w290g mutant
PDB Compounds: (A:) Galactose oxidase

SCOPe Domain Sequences for d2eida2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2eida2 b.18.1.0 (A:1-150) automated matches {Fusarium graminearum (Gibberella zeae) [TaxId: 5518]}
asapigsaisrnnwavtcdsaqsgnecnkaidgnkdtfwhtfygangdpkpphtytidmk
ttqnvnglsmlprqdgnqngwigrhevylssdgtnwgspvasgswfadsttkysnfetrp
aryvrlvaiteangqpwtsiaeinvfqass

SCOPe Domain Coordinates for d2eida2:

Click to download the PDB-style file with coordinates for d2eida2.
(The format of our PDB-style files is described here.)

Timeline for d2eida2: