| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) ![]() N-terminal domain is the classic Rossmann-fold |
| Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins) |
| Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species) |
| Species Escherichia coli [TaxId:562] [69771] (11 PDB entries) Uniprot P45568 |
| Domain d2egha3: 2egh A:126-274 [132123] Other proteins in same PDB: d2egha1, d2egha2, d2eghb1, d2eghb2 automatically matched to d1jvsa3 complexed with fom, mg, ndp |
PDB Entry: 2egh (more details), 2.2 Å
SCOPe Domain Sequences for d2egha3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2egha3 d.81.1.3 (A:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
slvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltgs
ggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasqm
evlihpqsvihsmvryqdgsvlaqlgepd
Timeline for d2egha3: