SCOPe 2.04: Domain d2efuc_: 2efu C:

Lineage for d2efuc_ (2efu C:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein D-Amino acid amidase DaaA [144038] (1 species)

7. Species Ochrobactrum anthropi [TaxId:529] [144039] (4 PDB entries)
   Uniprot Q9LCC8 2-363

8. Domain d2efuc_: 2efu C: [132111]
   automated match to d2dnsa1
   complexed with ba, phe

Details for d2efuc_

PDB Entry: 2efu, 2.3 Å

PDB Description: The crystal structure of D-amino acid amidase from Ochrobactrum anthropi SV3 complexed with L-phenylalanine

PDB Compounds: (C:) D-amino acid amidase

SCOPe Domain Sequences for d2efuc_:

Sequence; same for both SEQRES and ATOM records:

>d2efuc_ e.3.1.1 (C:) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]}
dlnnaiqgilddhvargvvgvslalclpgeetslyqsgyadkfnkmpmtgdhlfriasct
ksfiatglhllvqdgtvdldepitrwfpdlpkaaqmpvrillnhrsglpdfetsmpmisd
kswtaqeivdfsfrhgvqkepwhgmeysntgyvlagmiiahetgkpysdhlrsrifaplg
mkdtwvgthetfpiereargymhaaaddenpqwdvsgagdpvdgvwdstewfplsganaa
gdmvstprdivkflnalfdgrildqkrlwemkdnikpaffpgsntvanghglllmrygss
elkghlgqipghtsimgrdeetgaalmliqnsgagdfesfylkgvnepvdrvleaiknsr
s

Timeline for d2efuc_:

• d2efuc_ first appeared in SCOP 1.73, called d2efuc1
  
• d2efuc_ appears in SCOPe 2.03
  
• d2efuc_ appears in SCOPe 2.05
  
• d2efuc_ appears in the current release, SCOPe 2.08