SCOP 1.73: Domain d2e7qc1: 2e7q C:1-237

Lineage for d2e7qc1 (2e7q C:1-237)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (9 PDB entries)

8. Domain d2e7qc1: 2e7q C:1-237 [132066]
   automatically matched to d1wbfa_
   complexed with ca, fuc, gal, gla, glc, mn, nag, ndg

Details for d2e7qc1

PDB Entry: 2e7q, 2.75 Å

PDB Description: crystal structure of basic winged bean lectin in complex with b blood group trisaccharide

PDB Compounds: (C:) Basic agglutinin

SCOP Domain Sequences for d2e7qc1:

Sequence; same for both SEQRES and ATOM records:

>d2e7qc1 b.29.1.1 (C:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

Timeline for d2e7qc1:

• d2e7qc1 is new in SCOP 1.73
  
• d2e7qc1 appears in SCOP 1.75
  
• d2e7qc1 appears in the current release, SCOPe 2.08, called d2e7qc_