PDB entry 2e7q

View 2e7q on RCSB PDB site
Description: Crystal structure of basic winged bean lectin in complex with b blood group trisaccharide
Class: sugar binding protein
Keywords: winged bean, jelly roll, sugar binding protein
Deposited on 2007-01-12, released 2007-06-19
The last revision prior to the SCOP 1.73 freeze date was dated 2007-07-10, with a file datestamp of 2007-07-06.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.198
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e7qa1
  • Chain 'B':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e7qb1
  • Chain 'C':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e7qc1
  • Chain 'D':
    Compound: Basic agglutinin
    Species: Psophocarpus tetragonolobus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2e7qd1
  • Heterogens: CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7qA (A:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7qB (B:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7qC (C:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e7qD (D:)
    ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
    ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
    vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
    slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg