Lineage for d2dysy_ (2dys Y:)

  1. Root: SCOPe 2.02
  2. 1236525Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1237971Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1238228Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
  5. 1238229Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 1238230Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 1238231Species Cow (Bos taurus) [TaxId:9913] [81424] (23 PDB entries)
  8. 1238260Domain d2dysy_: 2dys Y: [131953]
    Other proteins in same PDB: d2dysa_, d2dysb1, d2dysb2, d2dysc_, d2dysd_, d2dyse_, d2dysf_, d2dysg_, d2dysh_, d2dysi_, d2dysj_, d2dysk_, d2dysm_, d2dysn_, d2dyso1, d2dyso2, d2dysp_, d2dysq_, d2dysr_, d2dyss_, d2dyst_, d2dysu_, d2dysv_, d2dysw_, d2dysx_, d2dysz_
    automated match to d1occl_
    complexed with cdl, chd, cu, cua, dcw, dmu, hea, mg, na, pek, pgv, psc, tgl, unx, zn

Details for d2dysy_

PDB Entry: 2dys (more details), 2.2 Å

PDB Description: Bovine heart cytochrome C oxidase modified by DCCD
PDB Compounds: (Y:) Cytochrome c oxidase polypeptide VIIc

SCOPe Domain Sequences for d2dysy_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dysy_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d2dysy_:

Click to download the PDB-style file with coordinates for d2dysy_.
(The format of our PDB-style files is described here.)

Timeline for d2dysy_: