Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) |
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins) contains a conserved all-alpha subdomain at the C-terminal extension |
Protein Glutamyl-tRNA synthetase (GluRS) [52382] (1 species) Catalytic domain is very similar to that of GlnRS |
Species Thermus thermophilus [TaxId:274] [52383] (11 PDB entries) |
Domain d2dxia2: 2dxi A:1-305 [131875] Other proteins in same PDB: d2dxia1, d2dxib1 automatically matched to d1g59a2 protein/RNA complex; complexed with atp, gau, mg |
PDB Entry: 2dxi (more details), 2.2 Å
SCOPe Domain Sequences for d2dxia2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dxia2 c.26.1.1 (A:1-305) Glutamyl-tRNA synthetase (GluRS) {Thermus thermophilus [TaxId: 274]} mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl ggpvf
Timeline for d2dxia2: