PDB entry 2dxi

View 2dxi on RCSB PDB site
Description: 2.2 A crystal structure of glutamyl-tRNA synthetase from Thermus thermophilus complexed with tRNA(Glu), ATP, and L-glutamol
Class: ligase/RNA
Keywords: LIGASE, RNA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ligase/RNA COMPLEX
Deposited on 2006-08-28, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.214
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dxia1, d2dxia2
  • Chain 'B':
    Compound: Glutamyl-tRNA synthetase
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dxib1, d2dxib2
  • Chain 'C':
    Compound: tRNA
    Species: synthetic, synthetic
  • Chain 'D':
    Compound: tRNA
    Species: synthetic, synthetic
  • Heterogens: MG, ATP, GAU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dxiA (A:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dxiB (B:)
    mvvtriapsptgdphvgtayialfnyawarrnggrfivriedtdraryvpgaeerilaal
    kwlglsydegpdvggphgpyrqserlplyqkyaeellkrgwayrafetpeeleqirkekg
    gydgrarnippeeaeerarrgephvirlkvprpgttevkdelrgvvvydnqeipdvvllk
    sdgyptyhlanvvddhlmgvtdviraeewlvstpihvllyrafgweaprfyhmpllrnpd
    ktkiskrkshtsldwykaegflpealrnylclmgfsmpdgreiftleefiqaftwervsl
    ggpvfdleklrwmngkyirevlsleevaervkpflreaglsweseaylrravelmrprfd
    tlkefpekarylftedypvsekaqrkleeglpllkelyprlraqeewteaaleallrgfa
    aekgvklgqvaqplraaltgsletpglfeilallgkeralrrlerala
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.