| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) ![]() |
| Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins) C-terminal domain is beta/alpha-barrel |
| Protein Hypothetical protein Bll6730 [117927] (1 species) |
| Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries) Uniprot Q89FH0 |
| Domain d2dw7k2: 2dw7 K:2-142 [131837] Other proteins in same PDB: d2dw7a1, d2dw7b1, d2dw7c1, d2dw7d1, d2dw7e1, d2dw7f1, d2dw7g1, d2dw7h1, d2dw7i1, d2dw7j1, d2dw7k1, d2dw7l1, d2dw7m1, d2dw7n1, d2dw7o1, d2dw7p1 automatically matched to d1tzzb2 complexed with mg, srt |
PDB Entry: 2dw7 (more details), 2.5 Å
SCOPe Domain Sequences for d2dw7k2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dw7k2 d.54.1.1 (K:2-142) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv
Timeline for d2dw7k2:
View in 3DDomains from other chains: (mouse over for more information) d2dw7a1, d2dw7a2, d2dw7b1, d2dw7b2, d2dw7c1, d2dw7c2, d2dw7d1, d2dw7d2, d2dw7e1, d2dw7e2, d2dw7f1, d2dw7f2, d2dw7g1, d2dw7g2, d2dw7h1, d2dw7h2, d2dw7i1, d2dw7i2, d2dw7j1, d2dw7j2, d2dw7l1, d2dw7l2, d2dw7m1, d2dw7m2, d2dw7n1, d2dw7n2, d2dw7o1, d2dw7o2, d2dw7p1, d2dw7p2 |