Lineage for d2dw7j2 (2dw7 J:2-142)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203262Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1203263Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 1203264Family d.54.1.1: Enolase N-terminal domain-like [54827] (14 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 1203373Protein Hypothetical protein Bll6730 [117927] (1 species)
  7. 1203374Species Bradyrhizobium japonicum [TaxId:375] [117928] (3 PDB entries)
    Uniprot Q89FH0
  8. 1203390Domain d2dw7j2: 2dw7 J:2-142 [131835]
    Other proteins in same PDB: d2dw7a1, d2dw7b1, d2dw7c1, d2dw7d1, d2dw7e1, d2dw7f1, d2dw7g1, d2dw7h1, d2dw7i1, d2dw7j1, d2dw7k1, d2dw7l1, d2dw7m1, d2dw7n1, d2dw7o1, d2dw7p1
    automatically matched to d1tzzb2
    complexed with mg, srt

Details for d2dw7j2

PDB Entry: 2dw7 (more details), 2.5 Å

PDB Description: Crystal structure of D-tartrate dehydratase from Bradyrhizobium japonicum complexed with Mg++ and meso-tartrate
PDB Compounds: (J:) Bll6730 protein

SCOPe Domain Sequences for d2dw7j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dw7j2 d.54.1.1 (J:2-142) Hypothetical protein Bll6730 {Bradyrhizobium japonicum [TaxId: 375]}
svrivdvreitkpisspirnayidftkmttslvavvtdvvregkrvvgygfnsngrygqg
glirerfasrileadpkkllneagdnldpdkvwaamminekpgghgersvavgtidmavw
davakiagkplfrllaerhgv

SCOPe Domain Coordinates for d2dw7j2:

Click to download the PDB-style file with coordinates for d2dw7j2.
(The format of our PDB-style files is described here.)

Timeline for d2dw7j2: