Lineage for d2dtyc_ (2dty C:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1532832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1532833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1532834Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1532994Protein Legume lectin [49904] (23 species)
  7. 1533300Species Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId:3891] [49909] (13 PDB entries)
  8. 1533333Domain d2dtyc_: 2dty C: [131739]
    automated match to d1wbfa_
    complexed with a2g, ca, mn

Details for d2dtyc_

PDB Entry: 2dty (more details), 2.65 Å

PDB Description: crystal structure of basic winged bean lectin complexed with n-acetyl- d-galactosamine
PDB Compounds: (C:) Basic agglutinin

SCOPe Domain Sequences for d2dtyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dtyc_ b.29.1.1 (C:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]}
ktisfnfnqfhqneeqlklqrdarissnsvleltkvvngvptwnstgralyakpvqvwds
ttgnvasfetrfsfsirqpfprphpadglvffiappntqtgegggyfgiynplspypfva
vefdtfrntwdpqiphigidvnsvistktvpftldnggianvvikydastkilhvvlvfp
slgtiytiadivdlkqvlpesvnvgfsaatgdpsgkqrnatethdilswsfsaslpg

SCOPe Domain Coordinates for d2dtyc_:

Click to download the PDB-style file with coordinates for d2dtyc_.
(The format of our PDB-style files is described here.)

Timeline for d2dtyc_: