SCOPe 2.04: Domain d2dt0a2: 2dt0 A:240-307

Lineage for d2dt0a2 (2dt0 A:240-307)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
   secreted during involution

7. Species Goat (Capra hircus) [TaxId:9925] [89883] (14 PDB entries)

8. Domain d2dt0a2: 2dt0 A:240-307 [131701]
   Other proteins in same PDB: d2dt0a1
   automatically matched to d1ljya2

Details for d2dt0a2

PDB Entry: 2dt0, 2.45 Å

PDB Description: crystal structure of the complex of goat signalling protein with the trimer of n-acetylglucosamine at 2.45a resolution

PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2dt0a2:

Sequence; same for both SEQRES and ATOM records:

>d2dt0a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Goat (Capra hircus) [TaxId: 9925]}
fgrsftlassktdvgapisgpgipgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

Timeline for d2dt0a2:

• d2dt0a2 first appeared in SCOP 1.73
  
• d2dt0a2 appears in SCOPe 2.03
  
• d2dt0a2 appears in SCOPe 2.05
  
• d2dt0a2 appears in the current release, SCOPe 2.08