Lineage for d2dr2a_ (2dr2 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1590099Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1590100Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1590101Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 1590194Protein Tryptophanyl-tRNA synthetase (TrpRS) [52378] (5 species)
    overall structure is similar to TyrRS
  7. 1590258Species Human (Homo sapiens) [TaxId:9606] [102256] (11 PDB entries)
    Uniprot P23381 94-471
  8. 1590275Domain d2dr2a_: 2dr2 A: [131653]
    automated match to d1o5ta_
    protein/RNA complex; complexed with so4, trp

Details for d2dr2a_

PDB Entry: 2dr2 (more details), 3 Å

PDB Description: Structure of human tryptophanyl-tRNA synthetase in complex with tRNA(Trp)
PDB Compounds: (A:) Tryptophanyl-tRNA synthetase

SCOPe Domain Sequences for d2dr2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dr2a_ c.26.1.1 (A:) Tryptophanyl-tRNA synthetase (TrpRS) {Human (Homo sapiens) [TaxId: 9606]}
gidydklivrfgsskidkelinrieratgqrphhflrrgiffshrdmnqvldayenkkpf
ylytgrgpsseamhvghlipfiftkwlqdvfnvplviqmtddekylwkdltldqaysyav
enakdiiacgfdinktfifsdldymgmssgfyknvvkiqkhvtfnqvkgifgftdsdcig
kisfpaiqaapsfsnsfpqifrdrtdiqclipcaidqdpyfrmtrdvaprigypkpallh
stffpalqgaqtkmsasdpnssifltdtakqiktkvnkhafsggrdtieehrqfggncdv
dvsfmyltffledddkleqirkdytsgamltgelkkalievlqpliaehqarrkevtdei
vkefmtprklsfd

SCOPe Domain Coordinates for d2dr2a_:

Click to download the PDB-style file with coordinates for d2dr2a_.
(The format of our PDB-style files is described here.)

Timeline for d2dr2a_: