Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (5 families) |
Family d.58.7.1: Canonical RBD [54929] (67 proteins) |
Protein HIV Tat-specific factor 1 [143290] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [143291] (1 PDB entry) Uniprot O43719 256-354 |
Domain d2dita1: 2dit A:8-106 [131533] |
PDB Entry: 2dit (more details)
SCOP Domain Sequences for d2dita1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} gpsrmrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfdrhpdgva svsfrdpeeadyciqtldgrwfggrqitaqawdgttdyq
Timeline for d2dita1: