Lineage for d2dita1 (2dit A:8-106)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2951927Protein HIV Tat-specific factor 1 [143290] (1 species)
  7. 2951928Species Human (Homo sapiens) [TaxId:9606] [143291] (1 PDB entry)
    Uniprot O43719 256-354
  8. 2951929Domain d2dita1: 2dit A:8-106 [131533]
    Other proteins in same PDB: d2dita2, d2dita3

Details for d2dita1

PDB Entry: 2dit (more details)

PDB Description: solution structure of the rrm_1 domain of hiv tat specific factor 1 variant
PDB Compounds: (A:) HIV TAT specific factor 1 variant

SCOPe Domain Sequences for d2dita1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]}
gpsrmrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfdrhpdgva
svsfrdpeeadyciqtldgrwfggrqitaqawdgttdyq

SCOPe Domain Coordinates for d2dita1:

Click to download the PDB-style file with coordinates for d2dita1.
(The format of our PDB-style files is described here.)

Timeline for d2dita1: