Lineage for d2dh1a1 (2dh1 A:1-232)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. Protein Legume lectin [49904] (23 species)
  7. Species Peanut (Arachis hypogaea) [TaxId:3818] [49912] (30 PDB entries)
    Uniprot P02872 24-255
  8. Domain d2dh1a1: 2dh1 A:1-232 [131517]
    automatically matched to d1bzwa_

Details for d2dh1a1

PDB Entry: 2dh1 (more details), 7.65 Å

PDB Description: Crystal structure of peanut lectin lactose-azobenzene-4,4'-dicarboxylic acid-lactose complex
PDB Compounds: (A:) Galactose-binding lectin

SCOPe Domain Sequences for d2dh1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dh1a1 b.29.1.1 (A:1-232) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]}
aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt

SCOPe Domain Coordinates for d2dh1a1 are not available.

Timeline for d2dh1a1:

Domains from other chains:
(mouse over for more information)
d2dh1b1, d2dh1c1, d2dh1d1