PDB entry 2dh1

View 2dh1 on RCSB PDB site
Description: Crystal structure of peanut lectin lactose-azobenzene-4,4'-dicarboxylic acid-lactose complex
Class: sugar binding protein
Keywords: legume lectin, agglutinin, crosslink, open quaternary structure, carbohydrate specificity, multivalency, sugar binding protein
Deposited on 2006-03-17, released 2006-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 7.65 Å
R-factor: 0.356
AEROSPACI score: -0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactose-binding lectin
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dh1a1
  • Chain 'B':
    Compound: Galactose-binding lectin
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dh1b1
  • Chain 'C':
    Compound: Galactose-binding lectin
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dh1c1
  • Chain 'D':
    Compound: Galactose-binding lectin
    Species: Arachis hypogaea [TaxId:3818]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2dh1d1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dh1A (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dh1A (A:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dh1B (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dh1B (B:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dh1C (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dh1C (C:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2dh1D (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitttrrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dh1D (D:)
    aetvsfnfnsfsegnpainfqgdvtvlsngniqltnlnkvnsvgrvlyampvriwssatg
    nvasfltsfsfemkdikdydpadgiiffiapedtqipagsigggtlgvsdtkgaghfvgv
    efdtysnseyndpptdhvgidvnsvdsvktvpwnsvsgavvkvtviydsstktlsvavtn
    dngdittiaqvvdlkaklpervkfgfsasgslggrqihlirswsftstlitt