Lineage for d2deka_ (2dek A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2519171Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2519172Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2519414Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2519415Protein automated matches [190076] (5 species)
    not a true protein
  7. 2519421Species Pyrococcus horikoshii OT3 [TaxId:70601] [186797] (2 PDB entries)
  8. 2519422Domain d2deka_: 2dek A: [131430]
    automated match to d1vhva_
    complexed with na, sah

Details for d2deka_

PDB Entry: 2dek (more details), 1.65 Å

PDB Description: Crystal structure of project ID PH0725 from Pyrococcus horikoshii OT3 at 1.65 A resolution
PDB Compounds: (A:) Probable diphthine synthase

SCOPe Domain Sequences for d2deka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2deka_ c.90.1.0 (A:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2deka_:

Click to download the PDB-style file with coordinates for d2deka_.
(The format of our PDB-style files is described here.)

Timeline for d2deka_: