Class g: Small proteins [56992] (98 folds) |
Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily) alpha+beta metal(zinc)-bound fold |
Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) |
Family g.39.1.3: LIM domain [57736] (18 proteins) duplication: contains two (sub)domains of this fold |
Protein Four and a half LIM domains protein 2, FHL2 [144161] (1 species) Skeletal muscle lim-protein 3 |
Species Human (Homo sapiens) [TaxId:9606] [144162] (3 PDB entries) Uniprot Q14192 128-159! Uniprot Q14192 162-186! Uniprot Q14192 187-218! Uniprot Q14192 221-249! Uniprot Q14192 250-279! Uniprot Q14192 98-127 |
Domain d2d8za2: 2d8z A:33-64 [131342] Other proteins in same PDB: d2d8za3, d2d8za4 3rd LIM domain complexed with zn |
PDB Entry: 2d8z (more details)
SCOPe Domain Sequences for d2d8za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} vctacrkqlsgqrftarddfayclncfcdlya
Timeline for d2d8za2: