Lineage for d2d8za2 (2d8z A:33-64)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640292Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 2640293Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 2640448Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 2640501Protein Four and a half LIM domains protein 2, FHL2 [144161] (1 species)
    Skeletal muscle lim-protein 3
  7. 2640502Species Human (Homo sapiens) [TaxId:9606] [144162] (3 PDB entries)
    Uniprot Q14192 128-159! Uniprot Q14192 162-186! Uniprot Q14192 187-218! Uniprot Q14192 221-249! Uniprot Q14192 250-279! Uniprot Q14192 98-127
  8. 2640506Domain d2d8za2: 2d8z A:33-64 [131342]
    Other proteins in same PDB: d2d8za3, d2d8za4
    3rd LIM domain
    complexed with zn

Details for d2d8za2

PDB Entry: 2d8z (more details)

PDB Description: solution structure of the third lim domain of four and a half lim domains protein 2 (fhl-2)
PDB Compounds: (A:) Four and a half LIM domains 2

SCOPe Domain Sequences for d2d8za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]}
vctacrkqlsgqrftarddfayclncfcdlya

SCOPe Domain Coordinates for d2d8za2:

Click to download the PDB-style file with coordinates for d2d8za2.
(The format of our PDB-style files is described here.)

Timeline for d2d8za2: