Class b: All beta proteins [48724] (174 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.3: GatD N-terminal domain-like [141300] (1 family) |
Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein) PfamB PB010580 |
Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species) |
Species Methanobacterium thermoautotrophicum [TaxId:145262] [141304] (1 PDB entry) Uniprot O26802 2-73 |
Domain d2d6fa1: 2d6f A:2-73 [131303] Other proteins in same PDB: d2d6fa2, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3 protein/RNA complex; complexed with zn |
PDB Entry: 2d6f (more details), 3.15 Å
SCOPe Domain Sequences for d2d6fa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d6fa1 b.38.3.1 (A:2-73) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei sdariellekgs
Timeline for d2d6fa1: