SCOPe 2.02: Domain d2d6fa1: 2d6f A:2-73

Lineage for d2d6fa1 (2d6f A:2-73)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.3: GatD N-terminal domain-like [141300] (1 family)

5. Family b.38.3.1: GatD N-terminal domain-like [141301] (1 protein)
   PfamB PB010580

6. Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [141302] (2 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [141304] (1 PDB entry)
   Uniprot O26802 2-73

8. Domain d2d6fa1: 2d6f A:2-73 [131303]
   Other proteins in same PDB: d2d6fa2, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
   protein/RNA complex; complexed with zn

Details for d2d6fa1

PDB Entry: 2d6f, 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)

PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d2d6fa1:

Sequence; same for both SEQRES and ATOM records:

>d2d6fa1 b.38.3.1 (A:2-73) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
sdariellekgs

Timeline for d2d6fa1:

• d2d6fa1 first appeared in SCOP 1.73
  
• d2d6fa1 appears in SCOPe 2.01
  
• d2d6fa1 appears in SCOPe 2.03
  
• d2d6fa1 appears in the current release, SCOPe 2.08