Lineage for d2d69e1 (2d69 E:134-418)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818439Superfamily c.1.14: RuBisCo, C-terminal domain [51649] (1 family) (S)
  5. 818440Family c.1.14.1: RuBisCo, large subunit, C-terminal domain [51650] (1 protein)
    N-terminal domain is alpha+beta
  6. 818441Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [51651] (12 species)
  7. 818449Species Archaeon Pyrococcus horikoshii [TaxId:53953] [141850] (3 PDB entries)
    Uniprot O58677 134-424
  8. 818453Domain d2d69e1: 2d69 E:134-418 [131298]
    Other proteins in same PDB: d2d69a2, d2d69b2, d2d69d2, d2d69e2
    automatically matched to 2CWX A:134-424
    complexed with so4

Details for d2d69e1

PDB Entry: 2d69 (more details), 1.9 Å

PDB Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (E:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2d69e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d69e1 c.1.14.1 (E:134-418) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
kgpqfgvqgirefmgvkdrpltatvpkpkmgwsveeyaeiayelwsggidllkddenfts
fpfnrfeervrklyrvrdrveaetgetkeylinitgpvnimekraemvaneggqyvmidi
vvagwsalqymrevtedlglaihahramhaaftrnprhgitmlalakaarmigvdqihtg
tavgkmagnyeeikrindfllskwehirpvfpvasgglhpglmpelirlfgkdlviqagg
gvmghpdgpragakalrdaidaaiegvdldekaksspelkkslre

SCOP Domain Coordinates for d2d69e1:

Click to download the PDB-style file with coordinates for d2d69e1.
(The format of our PDB-style files is described here.)

Timeline for d2d69e1: