Lineage for d2d69b2 (2d69 B:8-133)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 862528Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (1 family) (S)
    C-terminal domain is beta/alpha barrel
  5. 862529Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)
  6. 862530Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)
  7. 862538Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143363] (3 PDB entries)
    Uniprot O58677 8-133
  8. 862540Domain d2d69b2: 2d69 B:8-133 [131295]
    Other proteins in same PDB: d2d69a1, d2d69b1, d2d69d1, d2d69e1
    automatically matched to 2CWX A:8-133
    complexed with so4

Details for d2d69b2

PDB Entry: 2d69 (more details), 1.9 Å

PDB Description: Crystal structure of the complex of sulfate ion and octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-2 crystal)
PDB Compounds: (B:) Ribulose bisphosphate carboxylase

SCOP Domain Sequences for d2d69b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d69b2 d.58.9.1 (B:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr
smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy
eylrhf

SCOP Domain Coordinates for d2d69b2:

Click to download the PDB-style file with coordinates for d2d69b2.
(The format of our PDB-style files is described here.)

Timeline for d2d69b2: