Lineage for d2d2sa1 (2d2s A:525-753)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 646820Fold a.118: alpha-alpha superhelix [48370] (23 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 647571Superfamily a.118.17: Cullin repeat-like [74788] (2 families) (S)
  5. 647578Family a.118.17.2: Exocyst complex component [140851] (2 proteins)
    includes Pfam PF03081
  6. 647582Protein Exocyst complex component EXO84 [140852] (1 species)
  7. 647583Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [140853] (1 PDB entry)
  8. 647584Domain d2d2sa1: 2d2s A:525-753 [131188]

Details for d2d2sa1

PDB Entry: 2d2s (more details), 2.85 Å

PDB Description: Crystal Structure of the Exo84p C-terminal Domains
PDB Compounds: (A:) Exocyst complex component EXO84

SCOP Domain Sequences for d2d2sa1:

Sequence, based on SEQRES records: (download)

>d2d2sa1 a.118.17.2 (A:525-753) Exocyst complex component EXO84 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmsstaqrlkfldegveeidielarlrfesavetlldiesqledlserisdeelmllnli
slkieqrreaissklsqsilssneivhlksgtenmiklglpeqaldlflqnrsnfiqdli
lqigsvdnptnyltqlavirfqtikktvedfqdifkelgakissilvdwcsdevdnhfkl
idkqllndemlspgsikssrkqidglkavgldfvykldefikknsdkir

Sequence, based on observed residues (ATOM records): (download)

>d2d2sa1 a.118.17.2 (A:525-753) Exocyst complex component EXO84 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
dmsstaqrlkfldegveeidielarlrfesavetlldiesqledlslmllnlislkieqr
reaissklsqsilssneivhlksgtenmiklglpeqaldlflqnrsnfiqdlilqivdnp
tnyltqlavirfqtikktvedfqdifkelgakissilvdwcsdevdnhfklidkqllnls
pgsikssrkqidglkavgldfvykldefikknsdkir

SCOP Domain Coordinates for d2d2sa1:

Click to download the PDB-style file with coordinates for d2d2sa1.
(The format of our PDB-style files is described here.)

Timeline for d2d2sa1: