PDB entry 2d2s

View 2d2s on RCSB PDB site
Description: Crystal Structure of the Exo84p C-terminal Domains
Class: endocytosis/exocytosis
Keywords: tethering complex, exocyst, Exo84p
Deposited on 2005-09-16, released 2005-11-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.269
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Exocyst complex component EXO84
    Species: Saccharomyces cerevisiae
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2d2sa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d2sA (A:)
    gshmsrdmsstaqrlkfldegveeidielarlrfesavetlldiesqledlserisdeel
    mllnlislkieqrreaissklsqsilssneivhlksgtenmiklglpeqaldlflqnrsn
    fiqdlilqigsvdnptnyltqlavirfqtikktvedfqdifkelgakissilvdwcsdev
    dnhfklidkqllndemlspgsikssrkqidglkavgldfvykldefikknsdkir
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d2sA (A:)
    dmsstaqrlkfldegveeidielarlrfesavetlldiesqledlslmllnlislkieqr
    reaissklsqsilssneivhlksgtenmiklglpeqaldlflqnrsnfiqdlilqivdnp
    tnyltqlavirfqtikktvedfqdifkelgakissilvdwcsdevdnhfklidkqllnls
    pgsikssrkqidglkavgldfvykldefikknsdkir