SCOPe 2.07: Domain d2d2ob2: 2d2o B:503-585

Lineage for d2d2ob2 (2d2o B:503-585)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Maltogenic amylase [51031] (4 species)

7. Species Thermoactinomyces vulgaris, TVAII [TaxId:2026] [51033] (12 PDB entries)

8. Domain d2d2ob2: 2d2o B:503-585 [131180]
   Other proteins in same PDB: d2d2oa1, d2d2oa3, d2d2ob1, d2d2ob3
   automated match to d1jl8a2
   complexed with ca

Details for d2d2ob2

PDB Entry: 2d2o, 2.1 Å

PDB Description: structure of a complex of thermoactinomyces vulgaris r-47 alpha- amylase 2 with maltohexaose demonstrates the important role of aromatic residues at the reducing end of the substrate binding cleft

PDB Compounds: (B:) Neopullulanase 2

SCOPe Domain Sequences for d2d2ob2:

Sequence; same for both SEQRES and ATOM records:

>d2d2ob2 b.71.1.1 (B:503-585) Maltogenic amylase {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]}
gnvrswhadkqanlyafvrtvqdqhvgvvlnnrgekqtvllqvpesggktwldcltgeev
hgkqgqlkltlrpyqgmilwngr

Timeline for d2d2ob2:

• d2d2ob2 first appeared in SCOP 1.73
  
• d2d2ob2 appears in SCOPe 2.06
  
• d2d2ob2 appears in the current release, SCOPe 2.08