Lineage for d2d1ob_ (2d1o B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)
  7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)
  8. Domain d2d1ob_: 2d1o B: [131135]
    automated match to d1b3db_
    complexed with ca, fa4, zn

Details for d2d1ob_

PDB Entry: 2d1o (more details), 2.02 Å

PDB Description: Stromelysin-1 (MMP-3) complexed to a hydroxamic acid inhibitor
PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d2d1ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d1ob_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

SCOPe Domain Coordinates for d2d1ob_ are not available.

Timeline for d2d1ob_:

Domains from other chains:
(mouse over for more information)
d2d1oa_