SCOPe 2.08: Domain d2d1ob_: 2d1o B:

Lineage for d2d1ob_ (2d1o B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Stromelysin-1 (MMP-3) [55536] (1 species)

7. Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (42 PDB entries)

8. Domain d2d1ob_: 2d1o B: [131135]
   automated match to d1b3db_
   complexed with ca, fa4, zn

Details for d2d1ob_

PDB Entry: 2d1o, 2.02 Å

PDB Description: Stromelysin-1 (MMP-3) complexed to a hydroxamic acid inhibitor

PDB Compounds: (B:) stromelysin-1

SCOPe Domain Sequences for d2d1ob_:

Sequence; same for both SEQRES and ATOM records:

>d2d1ob_ d.92.1.11 (B:) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]}
frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi
misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe
ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp

Timeline for d2d1ob_:

• d2d1ob_ first appeared in SCOP 1.73, called d2d1ob1
  
• d2d1ob_ appears in SCOPe 2.07