Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (15 families) |
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins) |
Protein Stromelysin-1 (MMP-3) [55536] (1 species) |
Species Human (Homo sapiens), fibroblast [TaxId:9606] [55537] (32 PDB entries) |
Domain d2d1ob1: 2d1o B:83-250 [131135] automatically matched to d1b3db_ complexed with ca, fa4, zn |
PDB Entry: 2d1o (more details), 2.02 Å
SCOP Domain Sequences for d2d1ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1ob1 d.92.1.11 (B:83-250) Stromelysin-1 (MMP-3) {Human (Homo sapiens), fibroblast [TaxId: 9606]} frtfpgipkwrkthltyrivnytpdlpkdavdsavekalkvweevtpltfsrlyegeadi misfavrehgdfypfdgpgnvlahayapgpgingdahfdddeqwtkdttgtnlflvaahe ighslglfhsantealmyplyhsltdltrfrlsqddingiqslygppp
Timeline for d2d1ob1: