| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (7 proteins) |
| Protein Actin [53073] (6 species) |
| Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries) |
| Domain d2d1ka1: 2d1k A:4-146 [131129] Other proteins in same PDB: d2d1kb_ automatically matched to d1hlua1 protein/DNA complex; complexed with atp, ca, mg |
PDB Entry: 2d1k (more details), 2.5 Å
SCOPe Domain Sequences for d2d1ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d1ka1 c.55.1.1 (A:4-146) Actin {Cow (Bos taurus) [TaxId: 9913]}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg
Timeline for d2d1ka1: