![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.6: ATPase domain of dehydratase reactivase alpha subunit [82440] (2 proteins) |
![]() | Protein Diol dehydratase-reactivating factor large subunit DdrA [142464] (1 species) |
![]() | Species Klebsiella oxytoca [TaxId:571] [142465] (2 PDB entries) Uniprot O68195 1-92,255-403! Uniprot O68195 404-606 |
![]() | Domain d2d0pc2: 2d0p C:1-92,C:255-403 [131088] Other proteins in same PDB: d2d0pa1, d2d0pb_, d2d0pc1, d2d0pd_ automatically matched to 2D0O A:1-92,A:255-403 complexed with ca, so4 |
PDB Entry: 2d0p (more details), 3 Å
SCOPe Domain Sequences for d2d0pc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0pc2 c.55.1.6 (C:1-92,C:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} mryiagidignsstevalatldeagaltithsalaettgikgtlrnvfgiqealalvarg agiavsdislirineatpvigdvametitetiXkaraipagnlellaqgrsvrvdvaaga eaimkavdgcgrldnvtgesgtniggmlehvrqtmaeltnkpsseifiqdllavdtsvpv svtgglagefsleqavgiasmvksdrlqmamiareieqklnidvqiggaeaeaailgalt tp
Timeline for d2d0pc2: