Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) |
Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (3 proteins) automatically mapped to Pfam PF02288 |
Protein automated matches [190586] (1 species) not a true protein |
Species Klebsiella oxytoca [TaxId:571] [187594] (2 PDB entries) |
Domain d2d0pb_: 2d0p B: [131086] Other proteins in same PDB: d2d0pa1, d2d0pa2, d2d0pa3, d2d0pc1, d2d0pc2, d2d0pc3 automated match to d2d0ob1 complexed with ca, so4 |
PDB Entry: 2d0p (more details), 3 Å
SCOPe Domain Sequences for d2d0pb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d0pb_ c.51.3.2 (B:) automated matches {Klebsiella oxytoca [TaxId: 571]} nhsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgi acdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfrd
Timeline for d2d0pb_: