Lineage for d2d0pb_ (2d0p B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882071Superfamily c.51.3: B12-dependent dehydatase associated subunit [52968] (2 families) (S)
  5. 2882108Family c.51.3.2: Dehydratase-reactivating factor beta subunit [82433] (3 proteins)
    automatically mapped to Pfam PF02288
  6. 2882116Protein automated matches [190586] (1 species)
    not a true protein
  7. 2882117Species Klebsiella oxytoca [TaxId:571] [187594] (2 PDB entries)
  8. 2882119Domain d2d0pb_: 2d0p B: [131086]
    Other proteins in same PDB: d2d0pa1, d2d0pa2, d2d0pa3, d2d0pc1, d2d0pc2, d2d0pc3
    automated match to d2d0ob1
    complexed with ca, so4

Details for d2d0pb_

PDB Entry: 2d0p (more details), 3 Å

PDB Description: structure of diol dehydratase-reactivating factor in nucleotide free form
PDB Compounds: (B:) diol dehydratase-reactivating factor small subunit

SCOPe Domain Sequences for d2d0pb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d0pb_ c.51.3.2 (B:) automated matches {Klebsiella oxytoca [TaxId: 571]}
nhsapaiaiavidgcdglwrevllgieeegipfrlqhhpagevvdsawqaarsspllvgi
acdrhmlvvhyknlpasaplftlmhhqdsqahrntgnnaarlvkgipfrd

SCOPe Domain Coordinates for d2d0pb_:

Click to download the PDB-style file with coordinates for d2d0pb_.
(The format of our PDB-style files is described here.)

Timeline for d2d0pb_: