SCOPe 2.01: Domain d2cy5a_: 2cy5 A:

Lineage for d2cy5a_ (2cy5 A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.2: Phosphotyrosine-binding domain (PTB) [50755] (13 proteins)
   Pfam PF00640

6. Protein automated matches [190580] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187584] (1 PDB entry)

8. Domain d2cy5a_: 2cy5 A: [131018]
   automated match to d2cy4a1
   complexed with ca

Details for d2cy5a_

PDB Entry: 2cy5, 1.9 Å

PDB Description: Crystal structure of phosphotyrosine binding (PTB) domain of epidermal growth factor receptor pathway substrate-8 (EPS8) related protein 1 from Mus musculus (form-2 crystal)

PDB Compounds: (A:) epidermal growth factor receptor pathway substrate 8-like protein 1

SCOPe Domain Sequences for d2cy5a_:

Sequence; same for both SEQRES and ATOM records:

>d2cy5a_ b.55.1.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
madvsqyhvnhlvtfclgeedgvhtvedasrklavmdsqgrvwaqemllrvspsqvtlld
pvskeelesypldaivrcdavmprgrsrsllllvcqeperaqpdvhffqglllgaelire
diqgalqnyr

Timeline for d2cy5a_:

• d2cy5a_ first appeared in SCOP 1.73, called d2cy5a1
  
• d2cy5a_ was called d2cy5a1 in SCOP 1.75
  
• d2cy5a_ appears in SCOPe 2.02
  
• d2cy5a_ appears in the current release, SCOPe 2.08