Lineage for d2cxla1 (2cxl A:83-247)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2738386Fold a.256: RUN domain-like [140740] (1 superfamily)
    multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other
  4. 2738387Superfamily a.256.1: RUN domain-like [140741] (1 family) (S)
  5. 2738388Family a.256.1.1: RUN domain [140742] (2 proteins)
    Pfam PF02759
  6. 2738389Protein Rap2 interacting protein X (RUFY3) [140743] (1 species)
  7. 2738390Species Mouse (Mus musculus) [TaxId:10090] [140744] (2 PDB entries)
    Uniprot Q9D394 65-231
  8. 2738392Domain d2cxla1: 2cxl A:83-247 [131011]
    automatically matched to 2CXF A:83-249

Details for d2cxla1

PDB Entry: 2cxl (more details), 3.2 Å

PDB Description: RUN domain of Rap2 interacting protein x, crystallized in I422 space group
PDB Compounds: (A:) rap2 interacting protein x

SCOPe Domain Sequences for d2cxla1:

Sequence, based on SEQRES records: (download)

>d2cxla1 a.256.1.1 (A:83-247) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedl

Sequence, based on observed residues (ATOM records): (download)

>d2cxla1 a.256.1.1 (A:83-247) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedl

SCOPe Domain Coordinates for d2cxla1:

Click to download the PDB-style file with coordinates for d2cxla1.
(The format of our PDB-style files is described here.)

Timeline for d2cxla1: