SCOPe 2.08: Domain d2cxla1: 2cxl A:83-247

Lineage for d2cxla1 (2cxl A:83-247)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.256: RUN domain-like [140740] (1 superfamily)
   multihelical; 3-helical bundle similar to one half of the DEATH domain fold is flanked by two alpha-hairpins forming a four-helical bundle; the axes of the three-helical and four-helical bundles are aproximately orthogonal to each other

4. Superfamily a.256.1: RUN domain-like [140741] (1 family)

5. Family a.256.1.1: RUN domain [140742] (2 proteins)
   Pfam PF02759

6. Protein Rap2 interacting protein X (RUFY3) [140743] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140744] (2 PDB entries)
   Uniprot Q9D394 65-231

8. Domain d2cxla1: 2cxl A:83-247 [131011]
   automatically matched to 2CXF A:83-249

Details for d2cxla1

PDB Entry: 2cxl, 3.2 Å

PDB Description: RUN domain of Rap2 interacting protein x, crystallized in I422 space group

PDB Compounds: (A:) rap2 interacting protein x

SCOPe Domain Sequences for d2cxla1:

Sequence, based on SEQRES records:

>d2cxla1 a.256.1.1 (A:83-247) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkakktflg
qnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkali
nkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedl

Sequence, based on observed residues (ATOM records):

>d2cxla1 a.256.1.1 (A:83-247) Rap2 interacting protein X (RUFY3) {Mouse (Mus musculus) [TaxId: 10090]}
manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
efyevnalmmeeegaiiagllvglnvidanfcmkgedl

Timeline for d2cxla1:

• d2cxla1 first appeared in SCOP 1.73
  
• d2cxla1 appears in SCOPe 2.07