SCOPe 2.04: Domain d2cwxa2: 2cwx A:8-133

Lineage for d2cwxa2 (2cwx A:8-133)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.9: RuBisCO, large subunit, small (N-terminal) domain [54966] (2 families)
   C-terminal domain is beta/alpha barrel

5. Family d.58.9.1: Ribulose 1,5-bisphosphate carboxylase-oxygenase [54967] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [54968] (12 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143363] (2 PDB entries)
   Uniprot O58677 8-133

8. Domain d2cwxa2: 2cwx A:8-133 [130957]
   Other proteins in same PDB: d2cwxa1, d2cwxe1

Details for d2cwxa2

PDB Entry: 2cwx, 2 Å

PDB Description: Crystal structure of octameric ribulose-1,5-bisphosphate carboxylase/oxygenase (Rubisco) from Pyrococcus horikoshii OT3 (form-1 crystal)

PDB Compounds: (A:) Ribulose bisphosphate carboxylase

SCOPe Domain Sequences for d2cwxa2:

Sequence, based on SEQRES records:

>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtwttlwklpemakr
smakvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppy
eylrhf

Sequence, based on observed residues (ATOM records):

>d2cwxa2 d.58.9.1 (A:8-133) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Pyrococcus horikoshii [TaxId: 53953]}
vewyldfvdlnyepgrdeliveyyfepngvspeeaagriasessigtlwklpemakrsma
kvfylekhgegyiakiaypltlfeegslvqlfsavagnvfgmkalknlrlldfhppyeyl
rhf

Timeline for d2cwxa2:

• d2cwxa2 first appeared in SCOP 1.73
  
• d2cwxa2 appears in SCOPe 2.03
  
• d2cwxa2 appears in SCOPe 2.05
  
• d2cwxa2 appears in the current release, SCOPe 2.08