SCOP 1.73: Domain d2cwva3: 2cwv A:97-211

Lineage for d2cwva3 (2cwv A:97-211)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (34 PDB entries)

8. Domain d2cwva3: 2cwv A:97-211 [130948]
   Other proteins in same PDB: d2cwva1, d2cwvb1
   automatically matched to d1av4_3
   complexed with 2ty, cu; mutant

Details for d2cwva3

PDB Entry: 2cwv, 1.85 Å

PDB Description: product schiff-base intermediate of copper amine oxidase from arthrobacter globiformis

PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d2cwva3:

Sequence; same for both SEQRES and ATOM records:

>d2cwva3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

Timeline for d2cwva3:

• d2cwva3 is new in SCOP 1.73
  
• d2cwva3 appears in SCOP 1.75
  
• d2cwva3 appears in the current release, SCOPe 2.08