Lineage for d1av4_3 (1av4 97-211)
- Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds) 
Fold d.17: Cystatin-like [54402] (7 superfamilies)
Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) 
Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
duplication: contains two domains of this fold
Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) Species Arthrobacter globiformis [TaxId:1665] [54421] (15 PDB entries) 
Domain d1av4_3: 1av4 97-211 [38050]
Other proteins in same PDB: d1av4_1
complexed with cu
Details for d1av4_3
PDB Entry: 1av4 (more details), 2.2 Å
PDB Description: crystal structures of the copper-containing amine oxidase from arthrobacter globiformis in the holo-and apo-forms: implications for the biogenesis of topa quinone
SCOP Domain Sequences for d1av4_3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1av4_3 d.17.2.1 (97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg
SCOP Domain Coordinates for d1av4_3:
Click to download the PDB-style file with coordinates for d1av4_3.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1av4_3:
- d1av4_3 first appeared (with stable ids) in SCOP 1.55
- d1av4_3 appears in SCOP 1.69
- d1av4_3 is called d1av4a3 in SCOP 1.73
- d1av4_3 appears in the current release, SCOPe 2.08, called d1av4a3
View in 3D
