Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) |
Family a.4.13.2: Sigma4 domain [88665] (5 proteins) |
Protein Sigma70 (SigA, RpoD) [88666] (4 species) |
Species Thermus thermophilus [TaxId:274] [88667] (9 PDB entries) Uniprot Q9WX78 |
Domain d2cw0p2: 2cw0 P:319-423 [130916] Other proteins in same PDB: d2cw0a1, d2cw0a2, d2cw0b1, d2cw0b2, d2cw0c1, d2cw0d1, d2cw0e1, d2cw0f1, d2cw0f3, d2cw0k1, d2cw0k2, d2cw0l1, d2cw0l2, d2cw0m1, d2cw0n1, d2cw0o1, d2cw0p1, d2cw0p3 automatically matched to d1iw7f2 complexed with mg, zn |
PDB Entry: 2cw0 (more details), 3.3 Å
SCOPe Domain Sequences for d2cw0p2:
Sequence, based on SEQRES records: (download)
>d2cw0p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg rehtleevgaffgvtrerirqienkalrklkyhesrtrklrdfld
>d2cw0p2 a.4.13.2 (P:319-423) Sigma70 (SigA, RpoD) {Thermus thermophilus [TaxId: 274]} tpigdekdsfygdfipdehlpspvdaatqsllseelekalsklsereamvlklrkglidg eevgaffgvtrerirqienkalrklkyhesrtrklrdfld
Timeline for d2cw0p2: