SCOPe 2.01: Domain d2cula1: 2cul A:2-231

Lineage for d2cula1 (2cul A:2-231)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families)

5. Family c.3.1.7: GidA-like [141946] (1 protein)
   part of Pfam PF01266

6. Protein GidA-related protein TTHA1897 [141947] (1 species)

7. Species Thermus thermophilus [TaxId:274] [141948] (1 PDB entry)
   Uniprot Q5SH33 2-231

8. Domain d2cula1: 2cul A:2-231 [130813]
   complexed with fad

Details for d2cula1

PDB Entry: 2cul, 1.65 Å

PDB Description: Crystal structure of the GidA-related protein from Thermus thermophilus HB8

PDB Compounds: (A:) Glucose-inhibited division protein A-related protein, probable oxidoreductase

SCOPe Domain Sequences for d2cula1:

Sequence, based on SEQRES records:

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}
aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevpetpstpgyrvryl
afhpeeweektfrlkrleglyavglcvregdyarmseegkrlaehllhel

Sequence, based on observed residues (ATOM records):

>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]}
aayqvlivgagfsgaetafwlaqkgvrvglltqsldavmmpflppkppfppgsllerayd
pkdervwafharakylleglrplhlfqatatglllegnrvvgvrtwegppargekvvlav
gsflgarlflggvveeagrlseasypdlledlsrlgfrfveregevppgyrvrylafhpe
eweektfrlkrleglyavglcvregdyarmseegkrlaehllhel

Timeline for d2cula1:

• d2cula1 first appeared in SCOP 1.73
  
• d2cula1 appears in SCOP 1.75
  
• d2cula1 appears in SCOPe 2.02
  
• d2cula1 appears in the current release, SCOPe 2.08