Lineage for d2ctda1 (2ctd A:8-60)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2639864Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
    simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC
  4. 2639865Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families) (S)
  5. 2639866Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)
  6. 2640067Protein Zinc finger protein 512, ZNF512 [144135] (1 species)
  7. 2640068Species Human (Homo sapiens) [TaxId:9606] [144136] (1 PDB entry)
    Uniprot Q96ME7 142-194! Uniprot Q96ME7 195-224
  8. 2640069Domain d2ctda1: 2ctd A:8-60 [130792]
    Other proteins in same PDB: d2ctda3, d2ctda4
    ZnF 1
    complexed with zn

Details for d2ctda1

PDB Entry: 2ctd (more details)

PDB Description: solution structure of two zf-c2h2 domains from human zinc finger protein 512
PDB Compounds: (A:) Zinc finger protein 512

SCOPe Domain Sequences for d2ctda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ctda1 g.37.1.1 (A:8-60) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}
rirkeppvyaagsleeqwyleivdkgsvscptcqavgrktieglkkhmenckq

SCOPe Domain Coordinates for d2ctda1:

Click to download the PDB-style file with coordinates for d2ctda1.
(The format of our PDB-style files is described here.)

Timeline for d2ctda1: