SCOPe 2.02: Domain d2ctda1: 2ctd A:8-60

Lineage for d2ctda1 (2ctd A:8-60)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Zinc finger protein 512, ZNF512 [144135] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [144136] (1 PDB entry)
   Uniprot Q96ME7 142-194! Uniprot Q96ME7 195-224

8. Domain d2ctda1: 2ctd A:8-60 [130792]
   ZnF 1
   complexed with zn

Details for d2ctda1

PDB Entry: 2ctd

PDB Description: solution structure of two zf-c2h2 domains from human zinc finger protein 512

PDB Compounds: (A:) Zinc finger protein 512

SCOPe Domain Sequences for d2ctda1:

Sequence; same for both SEQRES and ATOM records:

>d2ctda1 g.37.1.1 (A:8-60) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]}
rirkeppvyaagsleeqwyleivdkgsvscptcqavgrktieglkkhmenckq

Timeline for d2ctda1:

• d2ctda1 first appeared in SCOP 1.73
  
• d2ctda1 appears in SCOPe 2.01
  
• d2ctda1 appears in SCOPe 2.03
  
• d2ctda1 appears in the current release, SCOPe 2.08