SCOP 1.73: Domain d2csle1: 2csl E:1-124

Lineage for d2csle1 (2csl E:1-124)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.1: YjgF-like [55298] (2 families)
   forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.1.1: YjgF/L-PSP [55299] (10 proteins)
   some members possess an endoribonuclease activity inhibiting mRNA translation

6. Protein Putative translation intiation inhibitor TTHA0137 [143529] (1 species)

7. Species Thermus thermophilus [TaxId:274] [143530] (3 PDB entries)

8. Domain d2csle1: 2csl E:1-124 [130776]
   automatically matched to 2CSL A:1-124

Details for d2csle1

PDB Entry: 2csl, 2.5 Å

PDB Description: Crystal structure of TTHA0137 from Thermus Thermophilus HB8

PDB Compounds: (E:) protein translation intiation inhibitor

SCOP Domain Sequences for d2csle1:

Sequence; same for both SEQRES and ATOM records:

>d2csle1 d.79.1.1 (E:1-124) Putative translation intiation inhibitor TTHA0137 {Thermus thermophilus [TaxId: 274]}
meavktdrapaaigpyaqavkaggfvfvsgqiplapdgslvegdirvqtervmenlkavl
eaagsglsrvvqttcfladmedfpgfnevyaryftppyparatvavkalprgvrvevacv
alae

Timeline for d2csle1:

• d2csle1 is new in SCOP 1.73
  
• d2csle1 appears in SCOP 1.75
  
• d2csle1 appears in the current release, SCOPe 2.08, called d2csle_